Searching the RRID Resource Information Network
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
CIPK2-uPIC Resource Report Resource Website |
RRID:Addgene_117862 | CIPK2-uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | PMID: | insert amino acid sequence: MENKPSVLTERYEVGRLLGQGTFAKVYFGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMRIAKHPNVVELYEVMATKSRIYFVIEYCKGGELFNKVAKGKLKEDVAWKYFYQLISAVDFCHSRGVYHRDIKPENLLLDDNDNLKVSDFGLSALADCKRQDGLLHTTCGTPAYVAPEVINRKGYEGTKADIWSCGVVLFVLLAGYLPFHDTNLMEMYRKIGKADFKCPSWFAPEVKRLLCKMLDPNHETRITIAKIKESSWFRKGLHLKQKKMEKMEKQQVREATNPMEAGGSGQNENGENHEPPRLATLNAFDIIALSTGFGLAGLFGDVYDKRESRFASQKPASEIISKLVEVAKCLKLKIRKQGAGLFKLERVKEGKNGILTMDAEIFQVTPTFHLVEVKKCNGDTMEYQKLVEEDLRPALADIVWVWQGEKEKEEQLLQDEQGEQEPS | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:16 | 0 | |
|
SLAC-deltaC Resource Report Resource Website |
RRID:Addgene_117102 | SLAC-deltaC | Arabidopsis thaliana | Bleocin (Zeocin) | PMID: | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:13 | 0 | ||
|
SbMBP Resource Report Resource Website |
RRID:Addgene_117861 | SbMBP | Other | Bleocin (Zeocin) | PMID: | insert amino acid sequence: MSKVFTLEDVAKHNTKEDCWLIIGGKVYDVTKFLEDHPGGDDVLLSSTGKDATDDFEDVG HSNTARAMMDEYLVGEIDASTIPSRTKYVPPKQPHYNQDKTPEFVIKILQFLVPLAILGL AVAVRMYTKSESA | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:16 | 0 | |
|
SLAC1-FL Resource Report Resource Website |
RRID:Addgene_117100 | SLAC1-FL | Arabidopsis thaliana | Bleocin (Zeocin) | PMID: | Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:13 | 0 | ||
|
OsNRAT-uPIC Resource Report Resource Website |
RRID:Addgene_117866 | OsNRAT-uPIC | Other | Bleocin (Zeocin) | PMID: | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:16 | 0 | ||
|
CBL5-uPIC Resource Report Resource Website |
RRID:Addgene_117868 | CBL5-uPIC | Arabidopsis thaliana | Bleocin (Zeocin) | PMID: | Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:01:17 | 0 | ||
|
MP28444 – pFUSE2ss-aRD114_CHIg-mIgG2A Resource Report Resource Website |
RRID:Addgene_110555 | Anti-RD114 heavy chain | Other | Bleocin (Zeocin) | PMID:31702531 | Backbone Marker:Invivogen; Backbone Size:3431; Vector Backbone:pFUSEss; Vector Types:Mammalian Expression, Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:00:46 | 0 | ||
|
PP364 Resource Report Resource Website |
RRID:Addgene_104945 | hGH | Bleocin (Zeocin) | PMID:29311542 | Vector Backbone:PP117; Vector Types:; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:00:26 | 0 | |||
|
JC021 Resource Report Resource Website |
RRID:Addgene_104944 | G-CSF | Bleocin (Zeocin) | PMID:29311542 | Vector Backbone:PP117; Vector Types:; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:00:26 | 0 | |||
|
pBADZ-HisCre Resource Report Resource Website |
RRID:Addgene_111187 | Cre recombinase | Bleocin (Zeocin) | PMID:15568020 | The protocol for preparation of electro-competent cells of DH10MultiBacCre,which carry the plasmid of pBADZ HisCre and enable the production of Cre recombinase, is described in Fitzgerald et al. (2006). http://www.nature.com/articles/nmeth983 | Vector Backbone:pBAD22; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:00:49 | 0 | ||
|
pFUSEss-CHIg-mG1_CH2-3 Resource Report Resource Website |
RRID:Addgene_105851 | IgG1 heavy chain, IgG3 heavy chain | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4483; Vector Backbone:pFUSEss-CHIg-mG1 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | hybrid heavy chain of mouse IgG1 with CH2 derived from mouse IgG3 | 2023-03-31 01:00:29 | 0 | |
|
pFUSEss-CHIg-mG1_CH2charge Resource Report Resource Website |
RRID:Addgene_105852 | IgG1 heavy chain | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4474; Vector Backbone:pFUSEss-CHIg-mG1 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | mutated heavy chain of mouse IgG1, muatations: Gln274His; Val282Lys; Asn315Arg; Ala326Lys; | 2023-03-31 01:00:29 | 0 | |
|
pFUSEss-CHIg-mG1_CH1h-3 Resource Report Resource Website |
RRID:Addgene_105850 | IgG1 heavy chain, IgG3 heavy chain | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4483; Vector Backbone:pFUSEss-CHIg-mG1 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | hybrid heavy chain of mouse IgG1 with CH1 and hinge derived from mouse IgG3 | 2023-03-31 01:00:29 | 0 | |
|
pFUSEss-CHIg-mG3_CH2charge Resource Report Resource Website |
RRID:Addgene_105858 | IgG3 heavy chain | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4483; Vector Backbone:pFUSEss-CHIg-mG3 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | mutated heavy chain of mouse IgG3, muatations: His274Gln; Lys282Val; Arg315Asn; Lys326Ala; | 2023-03-31 01:00:30 | 0 | |
|
pFUSEss-CHIg-mG3_CH1h-1 Resource Report Resource Website |
RRID:Addgene_105856 | IgG1, IgG3 | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4474; Vector Backbone:pFUSEss-CHIg-mG3 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | hybrid heavy chain of mouse IgG3 with CH1 and hinge derived from mouse IgG1 | 2023-03-31 01:00:29 | 0 | |
|
pFUSEss-CHIg-mG1_h-3 Resource Report Resource Website |
RRID:Addgene_105854 | IgG1 heavy chain, IgG3 heavy chain | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4483; Vector Backbone:pFUSEss-CHIg-mG1 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | hybrid heavy chain of mouse IgG1 with hinge derived from mouse IgG3 | 2023-03-31 01:00:29 | 0 | |
|
pFUSEss-CHIg-mG3_Lys322Arg Resource Report Resource Website |
RRID:Addgene_105862 | IgG3 heavy chain | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4483; Vector Backbone:pFUSEss-CHIg-mG3; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | Lys322Arg in constant region of IgG1 heavy chain | 2023-03-31 01:00:30 | 0 | |
|
pFUSEss-CHIg-mG3_F(ab')2 Resource Report Resource Website |
RRID:Addgene_105860 | IgG3 F(ab')2 | Mus musculus | Bleocin (Zeocin) | PMID:29875771 | Backbone Marker:Invivogen; Backbone Size:4549; Vector Backbone:pFUSEss-CHIg-mG3 (modified); Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin) | 2023-03-31 01:00:30 | 0 | ||
|
pPICZ-pOst1-pro-alphaf(MUT2)-E2-Crimson Resource Report Resource Website |
RRID:Addgene_117663 | pOst1-pro-af(MUT2)-E2-Crimson | Other | Bleocin (Zeocin) | PMID:30314480 | Integration plasmid in the pAOX1 locus. | Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | This plasmid encodes the fluorescent protein E2-Crimson together with an hibrid secretion signal. This secretion signal is composed by the the signal sequence of Ost1 from Saccharomyces cerevisiae and the the native mating alpha factor pro region from Saccharomyces cerevisiae. The pro region has Glu at position 83. | 2023-03-31 01:01:15 | 0 |
|
pPICZ-pre-Ost1-pro-alphaf-Btl2 Resource Report Resource Website |
RRID:Addgene_117665 | pre-Ost1-pro-alphaf-Btl2 | Other | Bleocin (Zeocin) | PMID:30314480 | Integration plasmid in the pAOX1 locus. | Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin) | This plasmid encodes the lipase Btl2 together with an hibrid secretion signal. This secretion signal is composed by the the signal sequence of Ost1 from Saccharomyces cerevisiae and the the native mating alpha factor pro region from Saccharomyces cerevisiae. The pro region has Leucine at position 42. | 2023-03-31 01:01:15 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the FDI Lab - SciCrunch.org Resources search. From here you can search through a compilation of resources used by FDI Lab - SciCrunch.org and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that FDI Lab - SciCrunch.org has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on FDI Lab - SciCrunch.org then you can log in from here to get additional features in FDI Lab - SciCrunch.org such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into FDI Lab - SciCrunch.org you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The SciCrunch Infrastructure was developed as a cooperative data platform to be used by diverse communities in making data more FAIR.
scicrunch.org
