Searching the RRID Resource Information Network
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pDONR223-RAGE Resource Report Resource Website |
RRID:Addgene_23645 | RAGE | Homo sapiens | Spectinomycin | PMID:21107320 | The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections. A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately. | Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin | 2022-12-09 12:04:30 | 0 | |
|
AAV-PB-SRT-tdTomato_BC22 Resource Report Resource Website |
RRID:Addgene_193187 | Barcoded piggyBac tdTomato SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin | Barcode: CAGT | 2022-12-09 12:04:19 | 0 | |
|
AAV-PB-SRT-tdTomato_BC20 Resource Report Resource Website |
RRID:Addgene_193185 | Barcoded piggyBac tdTomato SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin | Barcode: TCAG | 2022-12-09 12:04:19 | 0 | |
|
pODN-mNG-ANLN Resource Report Resource Website |
RRID:Addgene_183834 | ANLN homology arms with mNeonGreen-linker | Homo sapiens | Ampicillin | PMID:36416720 | Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin | Homology arms contain point mutations to remove the sgRNA target site | 2022-12-14 12:04:03 | 0 | |
|
AAV-PB-SRT-tdTomato_BC11 Resource Report Resource Website |
RRID:Addgene_193174 | Barcoded piggyBac tdTomato SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin | Barcode: GAAG | 2022-12-14 12:04:24 | 0 | |
|
AAV-PB-SRT-tdTomato_BC23 Resource Report Resource Website |
RRID:Addgene_193188 | Barcoded piggyBac tdTomato SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin | Barcode: CTAG | 2022-12-14 12:04:24 | 0 | |
|
pODN-AAVS1-mR2-CAAX Resource Report Resource Website |
RRID:Addgene_183871 | AAVS1 homology arms with CMV-driven mRuby2-CAAX fusion | Homo sapiens | Ampicillin | PMID:36416720 | Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin | Homology arms contain point mutations to remove the sgRNA target site | 2022-12-14 12:04:04 | 0 | |
|
pX459-HypaCas9-mR2-RHOA_sgRNA Resource Report Resource Website |
RRID:Addgene_183877 | RHOA sgRNA spacer | Homo sapiens | Ampicillin | PMID:36416720 | Vector Backbone:pX459V2.0-HypaCas9-mRuby2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-14 12:04:05 | 0 | ||
|
pX459-HypaCas9-RHOA_sgRNA Resource Report Resource Website |
RRID:Addgene_183878 | RHOA sgRNA spacer | Homo sapiens | Ampicillin | PMID:36416720 | Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-14 12:04:05 | 0 | ||
|
pX459-HypaCas9-ANLN_sgRNA Resource Report Resource Website |
RRID:Addgene_183874 | ANLN sgRNA spacer | Homo sapiens | Ampicillin | PMID:36416720 | Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-14 12:04:04 | 0 | ||
|
pX459-HypaCas9-mR2-TUBA1B_sgRNA Resource Report Resource Website |
RRID:Addgene_183888 | TUBA1B sgRNA spacer | Homo sapiens | Ampicillin | PMID:36416720 | Vector Backbone:pX459V2.0-HypaCas9-mRuby2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-14 12:04:06 | 0 | ||
|
pX459-HypaCas9-TUBA1B_sgRNA Resource Report Resource Website |
RRID:Addgene_183889 | TUBA1B sgRNA spacer | Homo sapiens | Ampicillin | PMID:36416720 | Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-14 12:04:06 | 0 | ||
|
pX459-HypaCas9-MYH10_sgRNA Resource Report Resource Website |
RRID:Addgene_183887 | MYH10 sgRNA spacer | Homo sapiens | Ampicillin | PMID:36416720 | Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-12-14 12:04:06 | 0 | ||
|
PB-SRT-Puro_BC4 Resource Report Resource Website |
RRID:Addgene_193146 | Barcoded piggyBac Puro SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Barcode: CAAC | 2022-12-14 12:04:24 | 0 | |
|
pODN-mR2-MYH10 Resource Report Resource Website |
RRID:Addgene_183869 | MYH10 homology arms with mRuby2-linker | Homo sapiens | Ampicillin | PMID:36416720 | Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin | Homology arms contain point mutations to remove the sgRNA target site | 2022-12-14 12:04:04 | 0 | |
|
PXK-PX (1-125) Resource Report Resource Website |
RRID:Addgene_119114 | PXK-PX (1-125) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:01:07 | 0 | |
|
pDONR223-PXK Resource Report Resource Website |
RRID:Addgene_23723 | PXK | Homo sapiens | Spectinomycin | PMID:21107320 | The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections. A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately. | Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:21 | 0 | |
|
pDONR221-W279A-long-UBASH3A-Ntag Resource Report Resource Website |
RRID:Addgene_192095 | UBASH3A | Homo sapiens | Kanamycin | PMID: | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | W279A | 2022-12-04 12:04:10 | 0 | |
|
pDONR221-WT-short-UBASH3A-Ctag Resource Report Resource Website |
RRID:Addgene_192099 | UBASH3A | Homo sapiens | Kanamycin | PMID:31659016 | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:04:10 | 0 | ||
|
pDONR221-WT-long-UBASH3A-Ntag Resource Report Resource Website |
RRID:Addgene_192098 | UBASH3A | Homo sapiens | Kanamycin | PMID: | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:04:10 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the FDI Lab - SciCrunch.org Resources search. From here you can search through a compilation of resources used by FDI Lab - SciCrunch.org and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that FDI Lab - SciCrunch.org has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on FDI Lab - SciCrunch.org then you can log in from here to get additional features in FDI Lab - SciCrunch.org such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into FDI Lab - SciCrunch.org you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The SciCrunch Infrastructure was developed as a cooperative data platform to be used by diverse communities in making data more FAIR.
scicrunch.org
