Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Synthetic
Genetic Insert: GB_SynP minSlCHS
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193105 Copy
Species: Homo sapiens
Genetic Insert: PRDM14
Vector Backbone Description: Vector Backbone:pMSCV puro; Vector Types:Retroviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193678 Copy
Species: Mus musculus
Genetic Insert: HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Predicted peptide sequences for 1D3 Heavy Chain:
MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK*
Proper citation: RRID:Addgene_170670 Copy
Species: Mus musculus
Genetic Insert: LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Predicted peptide sequences for 1D3 Light Chain:
MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*
Proper citation: RRID:Addgene_170669 Copy
Species: Synthetic
Genetic Insert: GB_SynP (A2) G1e.1
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193135 Copy
Species: Synthetic
Genetic Insert: GB_SynP (A2) G1abc.5
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193132 Copy
Species: Synthetic
Genetic Insert: GB_SynP (A2) G1abc.3
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193130 Copy
Species: Homo sapiens
Genetic Insert: Noa1-HIS
Vector Backbone Description: Vector Backbone:pEXP1-DEST; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_191972 Copy
Species: Homo sapiens
Genetic Insert: IFNGR1
Vector Backbone Description: Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192786 Copy
Species: Homo sapiens
Genetic Insert: IFNAR1
Vector Backbone Description: Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192784 Copy
Species: Other
Genetic Insert: antiGFP nanobody enhancer
Vector Backbone Description: Backbone Marker:EMD Biosciences; Backbone Size:5443; Vector Backbone:pet21a (+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Reference to anti-GFP nanobody enhancer:
Kirchhofer A, Helma J, Schmidthals K, Frauer C, Cui S, Karcher A, Pellis M, Muyldermans S, Casas-Delucchi CS, Cardoso MC, Leonhardt H, Hopfner KP, Rothbauer U. Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol. 2010 Jan;17(1):133-8. doi: 10.1038/nsmb.1727. Epub 2009 Dec 13. PMID: 20010839.
Proper citation: RRID:Addgene_192788 Copy
Species: Synthetic
Genetic Insert: GB_SynP (A2) G1ab.6
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193125 Copy
Species: Homo sapiens
Genetic Insert: sgRNA targeting alpha satellites on human chromosome 9
Vector Backbone Description: Backbone Size:7100; Vector Backbone:pSIN-U6-tracer_sgRNA_-EF1a-Thy1.1-P2A-Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_191397 Copy
Species: Mus musculus
Genetic Insert: Anti-Hec1 light chain (Hec1-ms_IgG_LC)
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_193619 Copy
Species:
Genetic Insert: Arrestin-TEVp(WT)-V5; UAS-mCherry
Vector Backbone Description: Vector Backbone:pPB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_173121 Copy
Species:
Genetic Insert: CCR6-hLOV-TEVcs-Gal4
Vector Backbone Description: Vector Backbone:pPB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_173120 Copy
Species: Other
Genetic Insert: Opa1
Vector Backbone Description: Vector Backbone:Gateway destination vector; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_191961 Copy
Species: Synthetic
Genetic Insert: GB_SynP minNtTA29
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193107 Copy
Species:
Genetic Insert: CCR6-eLOV-TEVcs-Gal4
Vector Backbone Description: Vector Backbone:pPB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_173119 Copy
Species: Synthetic
Genetic Insert: GB_SynP minNtPCPS2
Vector Backbone Description: Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol
References:
Comments:
Proper citation: RRID:Addgene_193109 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.