Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:homo sapiens (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

61,368 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pDONR223-RAGE
 
Resource Report
Resource Website
RRID:Addgene_23645 RAGE Homo sapiens Spectinomycin PMID:21107320 The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections. A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately. Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin 2022-12-09 12:04:30 0
AAV-PB-SRT-tdTomato_BC22
 
Resource Report
Resource Website
RRID:Addgene_193187 Barcoded piggyBac tdTomato SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin Barcode: CAGT 2022-12-09 12:04:19 0
AAV-PB-SRT-tdTomato_BC20
 
Resource Report
Resource Website
RRID:Addgene_193185 Barcoded piggyBac tdTomato SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin Barcode: TCAG 2022-12-09 12:04:19 0
pODN-mNG-ANLN
 
Resource Report
Resource Website
RRID:Addgene_183834 ANLN homology arms with mNeonGreen-linker Homo sapiens Ampicillin PMID:36416720 Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin Homology arms contain point mutations to remove the sgRNA target site 2022-12-14 12:04:03 0
AAV-PB-SRT-tdTomato_BC11
 
Resource Report
Resource Website
RRID:Addgene_193174 Barcoded piggyBac tdTomato SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin Barcode: GAAG 2022-12-14 12:04:24 0
AAV-PB-SRT-tdTomato_BC23
 
Resource Report
Resource Website
RRID:Addgene_193188 Barcoded piggyBac tdTomato SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin Barcode: CTAG 2022-12-14 12:04:24 0
pODN-AAVS1-mR2-CAAX
 
Resource Report
Resource Website
RRID:Addgene_183871 AAVS1 homology arms with CMV-driven mRuby2-CAAX fusion Homo sapiens Ampicillin PMID:36416720 Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin Homology arms contain point mutations to remove the sgRNA target site 2022-12-14 12:04:04 0
pX459-HypaCas9-mR2-RHOA_sgRNA
 
Resource Report
Resource Website
RRID:Addgene_183877 RHOA sgRNA spacer Homo sapiens Ampicillin PMID:36416720 Vector Backbone:pX459V2.0-HypaCas9-mRuby2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-12-14 12:04:05 0
pX459-HypaCas9-RHOA_sgRNA
 
Resource Report
Resource Website
RRID:Addgene_183878 RHOA sgRNA spacer Homo sapiens Ampicillin PMID:36416720 Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-12-14 12:04:05 0
pX459-HypaCas9-ANLN_sgRNA
 
Resource Report
Resource Website
RRID:Addgene_183874 ANLN sgRNA spacer Homo sapiens Ampicillin PMID:36416720 Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-12-14 12:04:04 0
pX459-HypaCas9-mR2-TUBA1B_sgRNA
 
Resource Report
Resource Website
RRID:Addgene_183888 TUBA1B sgRNA spacer Homo sapiens Ampicillin PMID:36416720 Vector Backbone:pX459V2.0-HypaCas9-mRuby2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-12-14 12:04:06 0
pX459-HypaCas9-TUBA1B_sgRNA
 
Resource Report
Resource Website
RRID:Addgene_183889 TUBA1B sgRNA spacer Homo sapiens Ampicillin PMID:36416720 Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-12-14 12:04:06 0
pX459-HypaCas9-MYH10_sgRNA
 
Resource Report
Resource Website
RRID:Addgene_183887 MYH10 sgRNA spacer Homo sapiens Ampicillin PMID:36416720 Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-12-14 12:04:06 0
PB-SRT-Puro_BC4
 
Resource Report
Resource Website
RRID:Addgene_193146 Barcoded piggyBac Puro SRT Homo sapiens Ampicillin PMID:36062164 Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Barcode: CAAC 2022-12-14 12:04:24 0
pODN-mR2-MYH10
 
Resource Report
Resource Website
RRID:Addgene_183869 MYH10 homology arms with mRuby2-linker Homo sapiens Ampicillin PMID:36416720 Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin Homology arms contain point mutations to remove the sgRNA target site 2022-12-14 12:04:04 0
PXK-PX (1-125)
 
Resource Report
Resource Website
RRID:Addgene_119114 PXK-PX (1-125) Homo sapiens Ampicillin PMID:30948714 Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin 2022-12-04 12:01:07 0
pDONR223-PXK
 
Resource Report
Resource Website
RRID:Addgene_23723 PXK Homo sapiens Spectinomycin PMID:21107320 The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections. A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately. Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin 2022-12-04 12:04:21 0
pDONR221-W279A-long-UBASH3A-Ntag
 
Resource Report
Resource Website
RRID:Addgene_192095 UBASH3A Homo sapiens Kanamycin PMID: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin W279A 2022-12-04 12:04:10 0
pDONR221-WT-short-UBASH3A-Ctag
 
Resource Report
Resource Website
RRID:Addgene_192099 UBASH3A Homo sapiens Kanamycin PMID:31659016 Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2022-12-04 12:04:10 0
pDONR221-WT-long-UBASH3A-Ntag
 
Resource Report
Resource Website
RRID:Addgene_192098 UBASH3A Homo sapiens Kanamycin PMID: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2022-12-04 12:04:10 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. RRID Portal Resources

    Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.