Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: immunoglobulin heavy constant mu
Vector Backbone Description: Backbone Marker:Invivogen; Backbone Size:4852; Vector Backbone:pFUSEss-CHIg-mM; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_91750 Copy
Species: Drosophila melanogaster
Genetic Insert: Act5C
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:3328; Vector Backbone:pPICZ B; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: Insert was expressed in fusion with beta-thymosin4. Can be expressed in GS115.
Proper citation: RRID:Addgene_184313 Copy
Species:
Genetic Insert: OsTIR1
Vector Backbone Description: Backbone Marker:Näätsaari et al., 2012; Vector Backbone:pPpT4; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_189725 Copy
Species:
Genetic Insert: OsTIR1
Vector Backbone Description: Backbone Marker:Näätsaari et al., 2012; Vector Backbone:pPpT4; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_189726 Copy
Species:
Genetic Insert: OsTIR1
Vector Backbone Description: Backbone Marker:Näätsaari et al., 2012; Vector Backbone:pPpT4; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_189728 Copy
Species: Synthetic
Genetic Insert: Clone 6 heavy chain (HH06)
Vector Backbone Description: Vector Backbone:pFuse; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_192176 Copy
Species: Synthetic
Genetic Insert: Clone 2 heavy chain (HH02)
Vector Backbone Description: Vector Backbone:pFuse; Vector Types:Mammalian Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_192175 Copy
Species: Other
Genetic Insert: wheat GRF4-GIF1 chimera
Vector Backbone Description: Backbone Size:2076; Vector Backbone:pDONR-zeo; Vector Types:Other, Entry clon; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_160392 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtZIF1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: insert amino acid sequence: MAEEYKEALLEKQNYHDGCPGCKVEQMKQLRRGYPYLELSFVWIIVLSTSLPISSLYPFLYYMIEDFGVAKTEKDIGFYAGFVGCSFMLGRALTSVFWGIVADRYGRKPIILLGTISIAIFNALFGLSSNFWMAIGTRFLLGSFNCLLGTMKAYASEIFRDEYQATAMSAVSTAWGIGLIIGPALGGFLAQPADKYPNVFSQESLFGRFRYALPCFTISAFALLVTVLCCFIPETLHNHKLDSLSHDDSYDILEAASHESSPSTGKAGKNERKASQSLLKNWPLMSSIIVYCVLCLHDTAYSEIFALWANSPRKYGGLSYSTNEVGTVLAISGLGLFSFQVFVYPLAEKLLGPVLVTRYAGALMIPIQMSYPFIAGLSGLSLSLMLNCASILINVLSVSAITGLLILQNRAVDQSQRGAANGIAMTAMSLFKTVGPAGAGILFSWSERRLNAAFLPGSHMVFFVLNVIVVVGVALTFKPFLTTSRR
Proper citation: RRID:Addgene_117885 Copy
Species: Other
Genetic Insert: Vitis miR396-resistant GRF4-GIF1 chimera
Vector Backbone Description: Backbone Size:2076; Vector Backbone:pDONR-zeo; Vector Types:Other, Entry clon; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments:
Proper citation: RRID:Addgene_160395 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: STE2
Vector Backbone Description: Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: HMS clone ID number: ScCD00063803.
Proper citation: RRID:Addgene_133437 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: STE2
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: HMS clone ID number: ScCD00063802.
Proper citation: RRID:Addgene_133436 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: STE2
Vector Backbone Description: Vector Backbone:pPICZalpha; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: HMS clone ID number: ScCD00063799.
Proper citation: RRID:Addgene_133433 Copy
Species: Synthetic
Genetic Insert: pMD2.G(spei/spei)&12x601_tetO
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pCR™BluntII-TOPO®; Vector Types:Bacterial Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: High copy plasmid (pUC-based, but medium yield)
Proper citation: RRID:Addgene_157785 Copy
Species: Other
Genetic Insert: luciferase
Vector Backbone Description: Backbone Marker:Thermo Fisher; Backbone Size:3600; Vector Backbone:pPICZ-alphaC; Vector Types:Yeast Expression, Luciferase; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: Please note: Plasmid contains a 39bp deletion that removes the N-terminal amino acids AQDCYEFTLEKRE from the luciferase compared to the depositor's insert sequence. It is not known how this discrepancy affects the plasmid function, though the plasmid was functional in the depositor's experiments.
Proper citation: RRID:Addgene_160426 Copy
Species: Other
Genetic Insert: OsSLAC1
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: insert amino acid sequence: MAAKPSSSSSSTGGHHTVDIRAAQAQPEDARQSAMSGPINIRGERRPPPMQRAFSRQVSLGSGVTVLGMDKVGKNGGRGQQRALPRSGKSLGVLNHTGALGQAAAGDGAARRGDFSMFRTKSTLSKQNSLLPSRIREPDLELPPHVEGPSVGRQGGEDPLNKSVPAGRYFAALRGPELDEVRDYEDILLPKDEVWPFLLRFPVGCFGVCLGLGSQAILWGALAASPAMRFLHVTPMINVALWLLALAVLVAVSVTYALKCVFYFEAIRREYFHPVRVNFFFAPSIAAMFLTIGLPRAVAPERLHPAVWCAFVAPLFGLELKIYGQWLSGGKRRLCKVANPSSHLSVVGNFVGAILAARVGWAEAGKFLWAIGVAHYIVVFVTLYQRLPTNEALPKELHPVYSMFIATPSAASLAWAAIYGSFDAVARTFFFMALFLYMSLVVRINFFRGFRFSIAWWSYTFPMTTASLATVKYAEAEPCFTSRALALSLSLMSTTMVSLLLVSTLLHAFVWRSLFPNDLAIAITKDRQNGAFKPHGKGRKAGKRVYDIKRWAKQAPLSLVSSITKSNSADKEEEEKTECGTENLYFQSGSHHHHHHHHHH
Proper citation: RRID:Addgene_117904 Copy
Species:
Genetic Insert: PGL3 luciferase siRNA
Vector Backbone Description: Backbone Marker:Moon Lab; Backbone Size:2167; Vector Backbone:pHIPPY; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: Inhibits the expression of PGL3 luciferase. Opposing human H1 and human U6 Pol III promoters drive expression of siRNAs
See article and author's map for more information. In the sequence link, the PGL3 luciferase siRNA is lower case.
Addgene QC Sanger sequencing did not identify BsmBI sites adjacent to the siRNA sequence.
Proper citation: RRID:Addgene_15099 Copy
Species:
Genetic Insert:
Vector Backbone Description: Backbone Marker:Moon Lab; Backbone Size:2167; Vector Backbone:pHIPPY; Vector Types:Mammalian Expression, RNAi; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: This construct is a blunt BsmB1 site version, for use as a NEGATIVE CONTROL for pHippy targetting of siRNAs in mammalian cells.
See article and author's map for more information.
Proper citation: RRID:Addgene_15098 Copy
Species: Arabidopsis thaliana
Genetic Insert: AtCOPT2 uPIC
Vector Backbone Description: Backbone Size:3329; Vector Backbone:pPICZc; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: insert amino acid sequence: MDHDHMHDMPPPSPSSSSMSNHTTPHMMMMHMTFFWGKNTEVLFSGWPGTSSGMYALCLIVIFLLAVIAEWLAHSPILRVSGSTNRAAGLAQTAVYTLKTGLSYLVMLAVMSFNAGVFIVAIAGYGVGFFLFGSTTFKKPSDDQKTAELLPPSSGCVCENLYQSHHHHHH
Proper citation: RRID:Addgene_117900 Copy
Species: Saccharomyces cerevisiae
Genetic Insert: STE2
Vector Backbone Description: Backbone Size:2900; Vector Backbone:pGAPZ; Vector Types:Yeast Expression; Bacterial Resistance:Bleocin (Zeocin)
References:
Comments: HMS clone ID number: ScCD00063805.
Proper citation: RRID:Addgene_133423 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the RRID Resources search. From here you can search through a compilation of resources used by RRID and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that RRID has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on RRID then you can log in from here to get additional features in RRID such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into RRID you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within RRID that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.