Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
URL: http://www.addgene.org/114876
Proper Citation: RRID:Addgene_114876
Insert Name: AT1G27190
Organism: Arabidopsis thaliana
Bacterial Resistance: Ampicillin
Defining Citation: PMID:29320478
Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin
Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: SAEDDVLCLQGLKNSLIDPSSRLSSWSFPNSSASSICKLTGVSCWNEKENRIISLQLQSMQLAGEIPESLKLCRSLQSLDLSGNDLSGSIPSQICSWLPYLVTLDLSGNKLGGSIPTQIVECKFLNALILSDNKLSGSIPSQLSRLDRLRRLSLAGNDLSGTIPSELARFGGDDFSGNNGLCGKPLSRCGALNGR
Expand AllWe found {{ ctrl2.mentions.all_count }} mentions in open access literature.
We have not found any literature mentions for this resource.
We are searching literature mentions for this resource.
Most recent articles:
{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})
A list of researchers who have used the resource and an author search tool
A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.
No rating or validation information has been found for BIR3 B11_pECIA14 .
No alerts have been found for BIR3 B11_pECIA14 .
Source: Addgene