Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Plasmid Name
RKL1 I6_pECIA14
RRID:Addgene_114781 RRID Copied  
PDF Report How to cite
RRID:Addgene_114781
Copy Citation Copied
Plasmid Information

URL: http://www.addgene.org/114781

Proper Citation: RRID:Addgene_114781

Insert Name: AT1G48480

Organism: Arabidopsis thaliana

Bacterial Resistance: Ampicillin

Defining Citation: PMID:29320478

Vector Backbone Description: Backbone Marker:Chris Garcia (Addgene plasmid # 47051); Vector Backbone:pECIA14; Vector Types:Insect Expression; Bacterial Resistance:Ampicillin

Comments: Plasmid for secreted expression in Drosophila cell culture by induction via CuSO4. Insert is an extracellular domain of indicated LRR-RK, C-terminally tagged with Pentameric rat COMP helix, Alkaline Phosphatase (human, placental), Flag, and hexahistidine tags. Insert Protein Sequence: QDLNADRTALLSLRSAVGGRTFRWNIKQTSPCNWAGVKCESNRVTALRLPGVALSGDIPEGIFGNLTQLRTLSLRLNALSGSLPKDLSTSSNLRHLYLQGNRFSGEIPEVLFSLSHLVRLNLASNSFTGEISSGFTNLTKLKTLFLENNQLSGSIPDLDLPLVQFNVSNNSLNGSIPKNLQRFESDSFLQTSLCGKPLKLCPDEETVPSQPTSGGNRTPPSVEGSEEKKKKNKLS

Expand All
Usage and Citation Metrics

We found {{ ctrl2.mentions.all_count }} mentions in open access literature.

We have not found any literature mentions for this resource.

We are searching literature mentions for this resource.

Most recent articles:

{{ mention._source.dc.creators[0].familyName }} {{ mention._source.dc.creators[0].initials }}, et al. ({{ mention._source.dc.publicationYear }}) {{ mention._source.dc.title }} {{ mention._source.dc.publishers[0].name }}, {{ mention._source.dc.publishers[0].volume }}({{ mention._source.dc.publishers[0].issue }}), {{ mention._source.dc.publishers[0].pagination }}. (PMID:{{ mention._id.replace('PMID:', '') }})

Checkfor all resource mentions.

Collaborator Network

A list of researchers who have used the resource and an author search tool

Find mentions based on location


{{ ctrl2.mentions.errors.location }}

A list of researchers who have used the resource and an author search tool. This is available for resources that have literature mentions.

Ratings and Alerts

No rating or validation information has been found for RKL1 I6_pECIA14 .

No alerts have been found for RKL1 I6_pECIA14 .

Data and Source Information

Source: Addgene