Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Bacterial Resistance:streptomycin (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

197 Results - per page

Show More Columns | Download 197 Result(s)

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pSH424-ssr
 
Resource Report
Resource Website
RRID:Addgene_198026 T0 terminator - Sm resistance cassette Synthetic Streptomycin PMID:37798358 Backbone Size:4948; Vector Backbone:pSH624-ssr; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2023-10-12 01:04:43 0
HE_50
 
Resource Report
Resource Website
RRID:Addgene_201049 n/a Streptomycin PMID: This strain has 572 genetic changes compared to the DH10B reference genome in Genbank (CP000948.1). Please see https://www.ncbi.nlm.nih.gov/nuccore/CP110017 and the accompanying paper for more details. Vector Backbone:n/a; Vector Types:Other; Bacterial Resistance:Streptomycin 2023-05-20 01:04:11 0
pMCRi
 
Resource Report
Resource Website
RRID:Addgene_207524 xylS (cured of BsaI-sites), Pm→ Sp dCas9, PEM7 →sgRNA; SmR/SpR Streptomycin PMID:38180826 Vector Backbone:pSEVA448; Vector Types:Other, Pseudomonas vector; Bacterial Resistance:Streptomycin 2024-01-30 12:16:59 0
pAblo
 
Resource Report
Resource Website
RRID:Addgene_207528 plasmid for adenine base editing; oriV(pRO1600/ColE1), xylS, Pm→repA, P14b→msfGFP; Pm→ ABE:SpRY, PEM7→non-specific sgRNA Streptomycin PMID:38180826 Backbone Marker:SEVA collection; Vector Backbone:pSEVA448; Vector Types:CRISPR, Other, Pseudomonas vector; Bacterial Resistance:Streptomycin 2024-01-30 12:05:22 0
pS44i8GH-1
 
Resource Report
Resource Website
RRID:Addgene_207525 oriV(pRO1600/ColE1), xylS, Pm→repA, P14b with a translational BCD2 coupler from BG35 (53)→msfGFP; Streptomycin PMID:38180826 Backbone Marker:SEVA collection; Vector Backbone:pSEVA448; Vector Types:CRISPR, Other, Pseudomonas vector; Bacterial Resistance:Streptomycin 2024-01-30 12:17:52 0
pEditA
 
Resource Report
Resource Website
RRID:Addgene_207531 Plasmid for adenine base editing; oriV(pRO1600/ColE1), xylS (cured of BsaI-sites), Pm→ ABE:SpnCas9, PEM7→non-specific sgRNA Streptomycin PMID:38180826 Backbone Marker:SEVA collection; Vector Backbone:pSEVA448; Vector Types:CRISPR, Other, Pseudomonas vector; Bacterial Resistance:Streptomycin 2024-01-30 12:05:22 0
pJK_ToeRepG2_N19_trigger
 
Resource Report
Resource Website
RRID:Addgene_132747 ToeRepG2_N19_trigger Other Streptomycin PMID:31686032 Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2024-02-21 12:02:11 0
pJK_ToeRepG2_N64_trigger
 
Resource Report
Resource Website
RRID:Addgene_132746 ToeRepG2_N64_trigger Other Streptomycin PMID:31686032 Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2024-02-21 12:02:11 0
pJK_ToeRepG2_N02_trigger
 
Resource Report
Resource Website
RRID:Addgene_132745 ToeRepG2_N02_trigger Other Streptomycin PMID:31686032 Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2024-02-21 12:02:11 0
pAG_ToeRep_N09_trigger
 
Resource Report
Resource Website
RRID:Addgene_132740 ToeRep_N09_trigger Other Streptomycin PMID:31686032 Please visit https://www.biorxiv.org/content/10.1101/501783v1 for bioRxiv preprint. Backbone Size:3331; Vector Backbone:pCDFduet; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2024-02-21 12:02:10 0
pRAW-460
 
Resource Report
Resource Website
RRID:Addgene_200216 PaCas1, PaCas2-3 Other Streptomycin PMID:37710013 Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Cas2 R55E-N56D mutations 2023-12-16 12:04:55 0
pRAW-461
 
Resource Report
Resource Website
RRID:Addgene_200217 PaCas1, PaCas2-3 Other Streptomycin PMID:37710013 Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Cas2 K11D-R12E mutations 2023-12-16 12:04:55 0
pRAW-462
 
Resource Report
Resource Website
RRID:Addgene_200218 PaCas1, PaCas2-3 Other Streptomycin PMID:37710013 Backbone Size:2819; Vector Backbone:2S; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Cas2 K11D-R12E, R55E-N56D mutations 2023-12-16 12:04:55 0
pCas3-Sm
 
Resource Report
Resource Website
RRID:Addgene_208001 RhaR Streptomycin PMID:37975669 Please visit https://doi.org/10.1101/2023.06.29.547033 for bioRxiv preprint. Backbone Marker:Dongru Qiu, Hongwei D. Yu; Backbone Size:5216; Vector Backbone:pHERD30T; Vector Types:Mammalian Expression; Bacterial Resistance:Streptomycin 2023-12-16 12:05:12 0
pQCasTns(Vch)-entry(BsaI)
 
Resource Report
Resource Website
RRID:Addgene_190273 VchTniQ, VchCas5/8, VchCas7, VchCas6, VchTnsABC, CRISPR(BsaI) Other Streptomycin PMID:34478496 Vector Backbone:pCDFDuet-1; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin no 2023-12-06 12:04:26 0
pTdTomato-L5
 
Resource Report
Resource Website
RRID:Addgene_140994 tdTomato Other Streptomycin PMID:32829077 tdTomato: Improved monomeric red, orange and yellow fluorescent proteins derived from Discosoma sp. red fluorescent protein Shaner Nc, Campbell Re, Steinbach Pa, Giepmans Bng, Palmer Ae, Tsien Ry (2004). Nature Biotechnology, 22(12) , 1567-1572. doi: 10.1038/nbt1037. Vector Backbone:pMV361-strep; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin 2024-02-29 12:02:23 0
PCDF Bravo-PotH-OL1del
 
Resource Report
Resource Website
RRID:Addgene_216749 potH Other Streptomycin PMID: IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 1 (OL1) with the sequence of [FKISLAEMARAIPPYTELMEWADGQLSITLNLGNFLQLTDDPLYFDAYLQSLQ] is deleted. 2024-08-01 01:06:53 0
PCDF Bravo-PotH-OL2del
 
Resource Report
Resource Website
RRID:Addgene_216750 potH Other Streptomycin PMID: IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is deleted. 2024-08-01 01:06:53 0
PCDF Bravo-PotH-OL3/2sub
 
Resource Report
Resource Website
RRID:Addgene_216752 potH Other Streptomycin PMID: IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 2 (OL2) with the sequence of [WMGILKNNGVLNNFLLWLGVIDQPLTILHTN] is substituted with OL3 [ELLGGPDSIMIGRVLWQEFFNNRDW]. 2024-08-01 01:06:53 0
PCDF Bravo-PotH-OL3del
 
Resource Report
Resource Website
RRID:Addgene_216751 potH Other Streptomycin PMID: IPTG inducible Vector Backbone:PCDF Bravo ; Vector Types:Bacterial Expression; Bacterial Resistance:Streptomycin Outer loop 3 (OL3) with the sequence of [ELLGGPDSIMIGRVLWQEFFNNRDW] is deleted. 2024-08-01 01:06:53 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. NIDM Terminology Resources

    Welcome to the nidm-terms Resources search. From here you can search through a compilation of resources used by nidm-terms and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that nidm-terms has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on nidm-terms then you can log in from here to get additional features in nidm-terms such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into nidm-terms you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.