Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: KIF1B beta
Vector Backbone Description: Backbone Size:6287; Vector Backbone:pBa-FRB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: pBa vector is susceptable to recombination and should not be grown in fast growing bacteria or cloned using recombination.
XL 10-Gold, Stbl3, OmniMax2, DH5alpha, and XL 1-Blue are suitable growth strains.
Proper citation: RRID:Addgene_64287 Copy
Species: Mus musculus
Genetic Insert: mouse Ins2 gene partial
Vector Backbone Description: Backbone Marker:Life Technologies; Vector Backbone:pCR2.1-TOPO; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin and Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_53969 Copy
Species: Mus musculus
Genetic Insert: Erg (317-486)
Vector Backbone Description: Backbone Marker:Amersham; Backbone Size:4969; Vector Backbone:pGEX-4T1; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_66992 Copy
Species: Mus musculus
Genetic Insert: Rab7
Vector Backbone Description: Backbone Size:6280; Vector Backbone:pBa-FRB-3myc; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: pBa vector is susceptable to recombination and should not be grown in fast growing bacteria or cloned using recombination.
XL 10-Gold, Stbl3, OmniMax2, DH5alpha, and XL 1-Blue are suitable growth strains.
Proper citation: RRID:Addgene_64210 Copy
Species: Mus musculus
Genetic Insert: JNK interacting protein-1b (JIP-1b)(282-470)
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_52125 Copy
Species: Mus musculus
Genetic Insert: JNK interacting protein-1b (JIP-1b)(M1-5)
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_52128 Copy
Species: Mus musculus
Genetic Insert: JNK interacting protein-1b (JIP-1b)(282-707))
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_52126 Copy
Species: Mus musculus
Genetic Insert: JNK interacting protein-1b (JIP-1b)(282-707)(M1-5)
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_52134 Copy
Species: Mus musculus
Genetic Insert: Jnk interacting protein Jip1b(471-707)(M1+3+6)
Vector Backbone Description: Backbone Marker:invitrogen; Backbone Size:5446; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_52130 Copy
Species: Mus musculus
Genetic Insert: KLC3
Vector Backbone Description: Vector Backbone:N1 Cloning Vector; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_62760 Copy
Species: Mus musculus
Genetic Insert: UBC
Vector Backbone Description: Backbone Marker:Novagen; Backbone Size:3626; Vector Backbone:pET-23a; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_69555 Copy
Species: Mus musculus
Genetic Insert: Erg
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5400; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_66977 Copy
Species: Mus musculus
Genetic Insert: mSYD1B
Vector Backbone Description: Backbone Size:3984; Vector Backbone:pNICE-HA-N; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments: mSYD1B can be released without HA-tag (by XhoI / BamHI) or with HA-tag (e.g. by AgeI / BamHI).
Proper citation: RRID:Addgene_59362 Copy
Species: Mus musculus
Genetic Insert: CREB
Vector Backbone Description: Backbone Size:5500; Vector Backbone:CMV500; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: A-CREB aa sequence: DYKDDDDK-MASMTGGQQMGRDPDLEQRAEELARENEELEKEAEELEQELAELENRVAVLENQNKTLIEELKALKDLYCHKSD. The first 8 aa encode for the FLAG tag, the next 13 aa area a φ10 protein sequence, the next 31 aa are the amphipathic acidic extension, and the final group of aa are the mouse CREB leucine zipper, which continues to the natural C terminus of the protein.
Proper citation: RRID:Addgene_33371 Copy
Species: Mus musculus
Genetic Insert: Cam Kinase IV(1-313)
Vector Backbone Description: Backbone Marker:Maurer lab; Backbone Size:4265; Vector Backbone:pRSV-link; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: This CaMKIV has a R128A mutation. The depositor considers this a polymorphism that is not functionally relevant.
Proper citation: RRID:Addgene_45063 Copy
Species: Mus musculus
Genetic Insert: Net1
Vector Backbone Description: Backbone Size:6000; Vector Backbone:pEF-HA; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_28264 Copy
Species: Mus musculus
Genetic Insert: Map7-1783-end
Vector Backbone Description: Vector Backbone:pGEM-T; Vector Types:Bacterial Expression, Other; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_46071 Copy
Species: Mus musculus
Genetic Insert: Net1
Vector Backbone Description: Backbone Marker:Amersham; Backbone Size:5006; Vector Backbone:pGEX-KG; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Contains wt mNet1 (aa 1-595)
Proper citation: RRID:Addgene_28260 Copy
Species: Mus musculus
Genetic Insert: Map7-856-1351
Vector Backbone Description: Vector Backbone:pGEM-T; Vector Types:Bacterial Expression, Unspecified; Bacterial Resistance:Ampicillin
References:
Comments: Discrepancies between the Addgene QC sequence and full sequence do not affect function.
Proper citation: RRID:Addgene_46069 Copy
Species: Mus musculus
Genetic Insert: Notch-1 Intracellular Domain
Vector Backbone Description: Backbone Size:4352; Vector Backbone:pCS2+MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Alternate plasmid name: pCS2 NICv1744-6MT
To create pCS2+ NICV1744, the primer CCAGGATCCACCATGGTGCTGCTGTCCCGCAAGC was used with primer M95 (5'-TCGAACATTGACATCCATGCA-3') to generate a product that was digested with Bam HI and Bcl I, and ligated into the same sites in NΔE (Addgene plasmid #41737).
Proper citation: RRID:Addgene_41730 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant 2U24DK097771-09.
Email: info_at_ dknet.org
