Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species:
Genetic Insert:
Vector Backbone Description: Vector Backbone:pBAtC; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin
References:
Comments:
Proper citation: RRID:Addgene_189640 Copy
Species: Arabidopsis thaliana
Genetic Insert: TALE and DddAtox
Vector Backbone Description: Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin
References:
Comments:
Proper citation: RRID:Addgene_189641 Copy
Species: Arabidopsis thaliana
Genetic Insert: TALE and DddAtox and TadA 8e
Vector Backbone Description: Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin
References:
Comments:
Proper citation: RRID:Addgene_189642 Copy
Species: Arabidopsis thaliana
Genetic Insert: TALE and DddAtox and TadA 8e
Vector Backbone Description: Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin
References:
Comments:
Proper citation: RRID:Addgene_189643 Copy
Species: Arabidopsis thaliana
Genetic Insert: TALE and DddAtox
Vector Backbone Description: Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin
References:
Comments:
Proper citation: RRID:Addgene_189644 Copy
Species: Homo sapiens
Genetic Insert: PXK-PX (1-125)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS
Proper citation: RRID:Addgene_119114 Copy
Species: Drosophila melanogaster
Genetic Insert: Polycomb
Vector Backbone Description: Backbone Size:5680; Vector Backbone:pET-11d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183781 Copy
Species: Synthetic
Genetic Insert: U6-Nla repeat-BbsI-Nla repeat
Vector Backbone Description: Backbone Marker:Lucigen; Backbone Size:1812; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_178883 Copy
Species: Homo sapiens
Genetic Insert: PXK
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin
References:
Comments: The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections.
A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately.
Proper citation: RRID:Addgene_23723 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192095 Copy
Species: Synthetic
Genetic Insert: EF1a-NlaCas8c-bGH PolyA
Vector Backbone Description: Backbone Marker:Lucigen; Backbone Size:1993; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_178880 Copy
Species:
Genetic Insert: EF1a-NlaCas3c-bGH polyA
Vector Backbone Description: Backbone Marker:Lucigen; Backbone Size:1993; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_178881 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192099 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192098 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192097 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac Puro SRT
Vector Backbone Description: Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193159 Copy
Species: Other
Genetic Insert: Hydra Sp5
Vector Backbone Description: Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192994 Copy
Species: Danio rerio
Genetic Insert: Zebrafish Wnt3 promoter
Vector Backbone Description: Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192992 Copy
Species: Danio rerio
Genetic Insert: Zebrafish Sp5-like
Vector Backbone Description: Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_192999 Copy
Species: Other
Genetic Insert: Hydra Nematocilin A
Vector Backbone Description: Vector Backbone:pGEM-T; Vector Types:Other, cloning vector; Bacterial Resistance:Ampicillin
References:
Comments: Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint.
Proper citation: RRID:Addgene_193010 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.