Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pRPS5A-PTP-3Xflag Resource Report Resource Website |
RRID:Addgene_189640 | Spectinomycin | PMID:36456803 | Vector Backbone:pBAtC; Vector Types:Plant Expression; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:07 | 0 | ||||
|
pRPS5A-PTP-3Xflag-16S rRNA Left_G1397N Resource Report Resource Website |
RRID:Addgene_189641 | TALE and DddAtox | Arabidopsis thaliana | Spectinomycin | PMID:36456803 | Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:07 | 0 | ||
|
pRPS5A-PTP-3Xflag-16S rRNA Left_G1397C-ABE Resource Report Resource Website |
RRID:Addgene_189642 | TALE and DddAtox and TadA 8e | Arabidopsis thaliana | Spectinomycin | PMID:36456803 | Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:07 | 0 | ||
|
AatII-pRPS5A-PTP-3Xflag-16S rRNA Right_G1397C_ABE Resource Report Resource Website |
RRID:Addgene_189643 | TALE and DddAtox and TadA 8e | Arabidopsis thaliana | Spectinomycin | PMID:36456803 | Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:07 | 0 | ||
|
AatII-pRPS5A-PTP-3Xflag-16S rRNA Right_G1397N Resource Report Resource Website |
RRID:Addgene_189644 | TALE and DddAtox | Arabidopsis thaliana | Spectinomycin | PMID:36456803 | Vector Backbone:pBAtC; Vector Types:Plant Expression, TALEN; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:07 | 0 | ||
|
PXK-PX (1-125) Resource Report Resource Website |
RRID:Addgene_119114 | PXK-PX (1-125) | Homo sapiens | Ampicillin | PMID:30948714 | Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS | Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:01:07 | 0 | |
|
pET11-PC(75-390)-H6 Resource Report Resource Website |
RRID:Addgene_183781 | Polycomb | Drosophila melanogaster | Ampicillin | PMID:26802126 | Backbone Size:5680; Vector Backbone:pET-11d; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 6 His tag at the C-terminus | 2022-12-04 12:03:56 | 0 | |
|
pSmart HC Kan-U6-Nla-repeat-BbsI-Nla-repeat Resource Report Resource Website |
RRID:Addgene_178883 | U6-Nla repeat-BbsI-Nla repeat | Synthetic | Kanamycin | PMID:35051351 | Backbone Marker:Lucigen; Backbone Size:1812; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:03:45 | 0 | ||
|
pDONR223-PXK Resource Report Resource Website |
RRID:Addgene_23723 | PXK | Homo sapiens | Spectinomycin | PMID:21107320 | The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections. A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately. | Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin | 2022-12-04 12:04:21 | 0 | |
|
pDONR221-W279A-long-UBASH3A-Ntag Resource Report Resource Website |
RRID:Addgene_192095 | UBASH3A | Homo sapiens | Kanamycin | PMID: | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | W279A | 2022-12-04 12:04:10 | 0 | |
|
pSmart-EF1a-Nla-cas8 Resource Report Resource Website |
RRID:Addgene_178880 | EF1a-NlaCas8c-bGH PolyA | Synthetic | Kanamycin | PMID:35051351 | Backbone Marker:Lucigen; Backbone Size:1993; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:03:45 | 0 | ||
|
pSmart-EF1a-Nla-cas3 Resource Report Resource Website |
RRID:Addgene_178881 | EF1a-NlaCas3c-bGH polyA | Kanamycin | PMID:35051351 | Backbone Marker:Lucigen; Backbone Size:1993; Vector Backbone:pSmart HC Kan; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:03:45 | 0 | |||
|
pDONR221-WT-short-UBASH3A-Ctag Resource Report Resource Website |
RRID:Addgene_192099 | UBASH3A | Homo sapiens | Kanamycin | PMID:31659016 | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:04:10 | 0 | ||
|
pDONR221-WT-long-UBASH3A-Ntag Resource Report Resource Website |
RRID:Addgene_192098 | UBASH3A | Homo sapiens | Kanamycin | PMID: | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:04:10 | 0 | ||
|
pDONR221-WT-long-UBASH3A-Ctag Resource Report Resource Website |
RRID:Addgene_192097 | UBASH3A | Homo sapiens | Kanamycin | PMID: | Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-04 12:04:10 | 0 | ||
|
PB-SRT-Puro_BC17 Resource Report Resource Website |
RRID:Addgene_193159 | Barcoded piggyBac Puro SRT | Homo sapiens | Ampicillin | PMID:36062164 | Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Barcode: TGGT | 2022-12-04 12:04:11 | 0 | |
|
HySp5-337 Resource Report Resource Website |
RRID:Addgene_192994 | Hydra Sp5 | Other | Ampicillin | PMID:30659200 | Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | no DNA binding domain | 2022-12-04 12:04:11 | 0 | |
|
ZfWnt3:Luc Resource Report Resource Website |
RRID:Addgene_192992 | Zebrafish Wnt3 promoter | Danio rerio | Ampicillin | PMID:30659200 | Vector Backbone:pGL3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:04:11 | 0 | ||
|
ZfSp5l1 Resource Report Resource Website |
RRID:Addgene_192999 | Zebrafish Sp5-like | Danio rerio | Ampicillin | PMID:30659200 | Vector Backbone:pCS2; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-04 12:04:11 | 0 | ||
|
pGEM-T-Easy-NematocilinA Resource Report Resource Website |
RRID:Addgene_193010 | Hydra Nematocilin A | Other | Ampicillin | PMID: | Please visit for https://www.biorxiv.org/content/10.1101/2021.12.22.473838v1 bioRxiv preprint. | Vector Backbone:pGEM-T; Vector Types:Other, cloning vector; Bacterial Resistance:Ampicillin | 2022-12-04 12:04:11 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant 2U24DK097771-09.
Email: info_at_ dknet.org
