Searching the RRID Resource Information Network
Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
GB3408 Resource Report Resource Website |
RRID:Addgene_193105 | GB_SynP minSlCHS | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 03:25:46 | 0 | ||
|
pMSCV puro PRDM14 ΔSET+ΔZinc finger domains Resource Report Resource Website |
RRID:Addgene_193678 | PRDM14 | Homo sapiens | Ampicillin | PMID:34990589 | Vector Backbone:pMSCV puro; Vector Types:Retroviral; Bacterial Resistance:Ampicillin | Deletion of SET and Zinc finger domains | 2022-12-22 03:26:00 | 0 | |
|
1D3 HC Resource Report Resource Website |
RRID:Addgene_170670 | HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:36378644 | Predicted peptide sequences for 1D3 Heavy Chain: MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK* | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:19 | 0 | |
|
1D3 LC Resource Report Resource Website |
RRID:Addgene_170669 | LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:36378644 | Predicted peptide sequences for 1D3 Light Chain: MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:19 | 0 | |
|
GB3273 Resource Report Resource Website |
RRID:Addgene_193135 | GB_SynP (A2) G1e.1 | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 03:25:49 | 0 | ||
|
GB3278 Resource Report Resource Website |
RRID:Addgene_193132 | GB_SynP (A2) G1abc.5 | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 03:25:48 | 0 | ||
|
GB3276 Resource Report Resource Website |
RRID:Addgene_193130 | GB_SynP (A2) G1abc.3 | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 03:25:48 | 0 | ||
|
pEXP1-DEST-Noa1-HIS Resource Report Resource Website |
RRID:Addgene_191972 | Noa1-HIS | Homo sapiens | Ampicillin | PMID: | Vector Backbone:pEXP1-DEST; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | 2022-12-22 02:16:00 | 0 | ||
|
pSems-leader-mXFPm-IFNGR1(18-489) Resource Report Resource Website |
RRID:Addgene_192786 | IFNGR1 | Homo sapiens | Ampicillin | PMID:35474965 | Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | mXFPm: tryptophan 66 to phenylalanine, gluatmic acid 142 to asparagine and histidine 164 to asparagine | 2022-12-22 02:16:01 | 0 | |
|
pSems-leader-SNAPf-mXFPm-IFNAR1(28-557) Resource Report Resource Website |
RRID:Addgene_192784 | IFNAR1 | Homo sapiens | Ampicillin | PMID:35474965 | Backbone Marker:Covalys, NEB; Backbone Size:5787; Vector Backbone:pSEMS(26m); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | mXFPm: tryptophan 66 to phenylalanine, gluatmic acid 142 to asparagine and histidine 164 to asparagine | 2022-12-22 02:16:01 | 0 | |
|
pet21a-aGFPnb-enhancer-cys-linker-YbbR-(PAS)5-H6 Resource Report Resource Website |
RRID:Addgene_192788 | antiGFP nanobody enhancer | Other | Ampicillin | PMID:35474965 | Reference to anti-GFP nanobody enhancer: Kirchhofer A, Helma J, Schmidthals K, Frauer C, Cui S, Karcher A, Pellis M, Muyldermans S, Casas-Delucchi CS, Cardoso MC, Leonhardt H, Hopfner KP, Rothbauer U. Modulation of protein properties in living cells using nanobodies. Nat Struct Mol Biol. 2010 Jan;17(1):133-8. doi: 10.1038/nsmb.1727. Epub 2009 Dec 13. PMID: 20010839. | Backbone Marker:EMD Biosciences; Backbone Size:5443; Vector Backbone:pet21a (+); Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:16:01 | 0 | |
|
GB2887 Resource Report Resource Website |
RRID:Addgene_193125 | GB_SynP (A2) G1ab.6 | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 02:16:01 | 0 | ||
|
pSIN-U6-tracer_C9_1_-EF1a-Thy1.1-P2A-Neo Resource Report Resource Website |
RRID:Addgene_191397 | sgRNA targeting alpha satellites on human chromosome 9 | Homo sapiens | Ampicillin | PMID:28935858 | Backbone Size:7100; Vector Backbone:pSIN-U6-tracer_sgRNA_-EF1a-Thy1.1-P2A-Neo; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:59 | 0 | ||
|
pDL002_Hec1-ms_IgG_LC Resource Report Resource Website |
RRID:Addgene_193619 | Anti-Hec1 light chain (Hec1-ms_IgG_LC) | Mus musculus | Kanamycin | PMID:34970967 | Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-22 02:16:02 | 0 | ||
|
pPB UbC Arrestin-TEVp(WT)-V5; UAS-mCherry Resource Report Resource Website |
RRID:Addgene_173121 | Arrestin-TEVp(WT)-V5; UAS-mCherry | Ampicillin | PMID:35311648 | Vector Backbone:pPB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:24 | 0 | |||
|
pPB EF1a CCR6-hLOV-TEVcs-Gal4 Resource Report Resource Website |
RRID:Addgene_173120 | CCR6-hLOV-TEVcs-Gal4 | Ampicillin | PMID:35311648 | Vector Backbone:pPB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:24 | 0 | |||
|
pDEST-Opa1 Resource Report Resource Website |
RRID:Addgene_191961 | Opa1 | Other | Ampicillin | PMID: | Vector Backbone:Gateway destination vector; Vector Types:Synthetic Biology; Bacterial Resistance:Ampicillin | 2022-12-22 02:16:00 | 0 | ||
|
GB3410 Resource Report Resource Website |
RRID:Addgene_193107 | GB_SynP minNtTA29 | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 02:16:01 | 0 | ||
|
pPB EF1a CCR6-eLOV-TEVcs-Gal4 Resource Report Resource Website |
RRID:Addgene_173119 | CCR6-eLOV-TEVcs-Gal4 | Ampicillin | PMID:35311648 | Vector Backbone:pPB; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:24 | 0 | |||
|
GB3412 Resource Report Resource Website |
RRID:Addgene_193109 | GB_SynP minNtPCPS2 | Synthetic | Chloramphenicol | PMID:36044643 | Vector Backbone:pUPD2; Vector Types:Synthetic Biology; Bacterial Resistance:Chloramphenicol | 2022-12-22 02:16:01 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.
The NIDDK Information Network (dkNET) serves the needs of basic and clinical investigators by providing seamless access to large pools of data and research resources relevant to the mission of The National Institute of Diabetes Digestive and Kidney Diseases (NIDDK). dkNET is hosted at University of California San Diego, and is supported by NIH NIDDK grant 2U24DK097771-09.
Email: info_at_ dknet.org
