Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Mus musculus
Genetic Insert: Evi-1
Vector Backbone Description: Vector Backbone:pLV-EF1a-PGK-BFPT2aPuro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_101867 Copy
Species: Mus musculus
Genetic Insert: Mds1-Evi-1
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_101860 Copy
Species: Mus musculus
Genetic Insert: H2-Kd Balb/c
Vector Backbone Description: Backbone Size:2300; Vector Backbone:puc19; Vector Types:; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_102641 Copy
Species: Mus musculus
Genetic Insert: H2-Kd Balb/c
Vector Backbone Description: Backbone Marker:New England Biolabs, USA; Backbone Size:2300; Vector Backbone:puc19; Vector Types:; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_102642 Copy
Species: Mus musculus
Genetic Insert: cGAS
Vector Backbone Description: Vector Backbone:pcDNA3.1-Hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_102607 Copy
Species: Mus musculus
Genetic Insert: PPAR gamma coactivator 1 alpha
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5500; Vector Backbone:pcDNA3.1 myc-His A; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_1026 Copy
Species: Mus musculus
Genetic Insert: EphA2 N terminal (430-976aa)
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_102738 Copy
Species: Mus musculus
Genetic Insert: EphA2
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_102735 Copy
Species: Mus musculus
Genetic Insert: EphA2
Vector Backbone Description: Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_102731 Copy
Species: Mus musculus
Genetic Insert: PSD-95
Vector Backbone Description: Backbone Size:4141; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_102949 Copy
Species: Mus musculus
Genetic Insert: Ctnnb1
Vector Backbone Description: Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100883 Copy
Species: Mus musculus
Genetic Insert: Ctnnb1
Vector Backbone Description: Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100884 Copy
Species: Mus musculus
Genetic Insert: Ctnnb1
Vector Backbone Description: Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100878 Copy
Species: Mus musculus
Genetic Insert: alpha-Catenin
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments: The TS module with mTFP1-F40-venusA206K was adapted from Vinculin TS (a kind gift from Martin Schwartz [Grashoff et al., 2010]). The TSmod was cloned in to pEGFP-N1 vector at Xho1 and Not1 restriction sites. For aE-Cat-TS, the mouse N-terminal (1_697 aa) of alpha-catenin was inserted before mTFP1 by in- fusion cloning (Takara Bioscience, Clontech) at the Xho1 restriction site
Proper citation: RRID:Addgene_101298 Copy
Species: Mus musculus
Genetic Insert: alpha-Catenin
Vector Backbone Description: Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments: The C-terminal fragment (698-906 aa) of alpha-catenin was cloned after VenusA206K at the Not1 restriction site
Proper citation: RRID:Addgene_101299 Copy
Species: Mus musculus
Genetic Insert: Ezh2[SET]
Vector Backbone Description: Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100087 Copy
Species: Mus musculus
Genetic Insert: 14056
Vector Backbone Description: Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_100086 Copy
Species: Mus musculus
Genetic Insert: HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Predicted peptide sequences for 1D3 Heavy Chain:
MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK*
Proper citation: RRID:Addgene_170670 Copy
Species: Mus musculus
Genetic Insert: LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody
Vector Backbone Description: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments: Predicted peptide sequences for 1D3 Light Chain:
MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC*
Proper citation: RRID:Addgene_170669 Copy
Species: Mus musculus
Genetic Insert: Anti-Hec1 light chain (Hec1-ms_IgG_LC)
Vector Backbone Description: Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_193619 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.