Searching the RRID Resource Information Network

Our searching services are busy right now. Please try again later

  • Register
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

X

Leaving Community

Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.

No
Yes
X
Forgot Password

If you have forgotten your password you can enter your email here and get a temporary password sent to your email.

Preparing word cloud

×

Plasmids are provided by Addgene and DGRC.

Search

Type in a keyword to search

Filter by records added date
See new records

Options


Current Facets and Filters

  • Organism:mus musculus (facet)


Recent searches

Snippet view Table view
Click the to add this resource to a Collection

11,814 Results - per page

Show More Columns | Download Top 1000 Results

Plasmid Name Proper Citation Insert Name Organism Bacterial Resistance Defining Citation Comments Vector Backbone Description Relevant Mutation Record Last Update Mentions Count
pKAM-E-Flag-BFP
 
Resource Report
Resource Website
RRID:Addgene_101867 Evi-1 Mus musculus Ampicillin PMID: Vector Backbone:pLV-EF1a-PGK-BFPT2aPuro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin 2022-04-22 03:15:11 0
pcDNA3.1-ME-Flag
 
Resource Report
Resource Website
RRID:Addgene_101860 Mds1-Evi-1 Mus musculus Ampicillin PMID: Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-04-22 03:15:11 0
pUC19, containing H2-Kb c57/BL6 WK9
 
Resource Report
Resource Website
RRID:Addgene_102641 H2-Kd Balb/c Mus musculus Ampicillin PMID:28374766 Backbone Size:2300; Vector Backbone:puc19; Vector Types:; Bacterial Resistance:Ampicillin 2022-04-22 03:15:17 0
pUC19, containing H2-Kd Balb/c WK10
 
Resource Report
Resource Website
RRID:Addgene_102642 H2-Kd Balb/c Mus musculus Ampicillin PMID:28374766 Backbone Marker:New England Biolabs, USA; Backbone Size:2300; Vector Backbone:puc19; Vector Types:; Bacterial Resistance:Ampicillin 2022-04-22 03:15:17 0
pcDNA3.1-Hygro(+)-mscGAS
 
Resource Report
Resource Website
1+ mentions
RRID:Addgene_102607 cGAS Mus musculus Ampicillin PMID:26229115 Vector Backbone:pcDNA3.1-Hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-04-22 03:15:17 1
pcDNA-f:PGC1
 
Resource Report
Resource Website
RRID:Addgene_1026 PPAR gamma coactivator 1 alpha Mus musculus Ampicillin PMID:10983978 Backbone Marker:Invitrogen; Backbone Size:5500; Vector Backbone:pcDNA3.1 myc-His A; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-04-22 03:15:16 0
EphA2 430-976 pcDNA3.1
 
Resource Report
Resource Website
RRID:Addgene_102738 EphA2 N terminal (430-976aa) Mus musculus Ampicillin PMID:26744526 Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-04-22 03:15:19 0
Y771F EphA2 pcDNA3
 
Resource Report
Resource Website
RRID:Addgene_102735 EphA2 Mus musculus Ampicillin PMID:18387945 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Y771F (TAC > TTC) 2022-04-22 03:15:19 0
Y593E EphA2 pcDNA3
 
Resource Report
Resource Website
RRID:Addgene_102731 EphA2 Mus musculus Ampicillin PMID:18387945 Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin Y593E (TAC > GAG) 2022-04-22 03:15:19 0
pCMV-5U-Venus-PSD-95-3U
 
Resource Report
Resource Website
RRID:Addgene_102949 PSD-95 Mus musculus Kanamycin PMID:25948262 Backbone Size:4141; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2022-04-22 03:15:22 0
pCS2MT-mbeta-catenin delta6
 
Resource Report
Resource Website
RRID:Addgene_100883 Ctnnb1 Mus musculus Ampicillin PMID:28390865 Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin truncated Ctnnb1 489-781aa 2022-04-22 03:14:58 0
pCS2MT-mbeta-catenin delta7
 
Resource Report
Resource Website
RRID:Addgene_100884 Ctnnb1 Mus musculus Ampicillin PMID:28390865 Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin truncated Ctnnb1 668-781aa 2022-04-22 03:14:58 0
pCS2MT-mbeta-catenin delta1
 
Resource Report
Resource Website
RRID:Addgene_100878 Ctnnb1 Mus musculus Ampicillin PMID:28390865 Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin truncated Ctnnb1 1-150aa 2022-04-22 03:14:58 0
aCat TL2 (1-697 mTFP1-TSmod-Venus STOP)
 
Resource Report
Resource Website
RRID:Addgene_101298 alpha-Catenin Mus musculus Kanamycin PMID:28329679 The TS module with mTFP1-F40-venusA206K was adapted from Vinculin TS (a kind gift from Martin Schwartz [Grashoff et al., 2010]). The TSmod was cloned in to pEGFP-N1 vector at Xho1 and Not1 restriction sites. For aE-Cat-TS, the mouse N-terminal (1_697 aa) of alpha-catenin was inserted before mTFP1 by in- fusion cloning (Takara Bioscience, Clontech) at the Xho1 restriction site Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin Contains amino acids 1-698 of alpha-Catenin 2022-04-22 03:15:04 0
aCat TS WT (1-697 mTFP1-TSmod-Venus 698-907)
 
Resource Report
Resource Website
RRID:Addgene_101299 alpha-Catenin Mus musculus Kanamycin PMID:28329679 The C-terminal fragment (698-906 aa) of alpha-catenin was cloned after VenusA206K at the Not1 restriction site Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin Contains amino acids 1-698 and 698-906 of alpha-Catenin 2022-04-22 03:15:04 0
Ezh2[SET]-dCas9
 
Resource Report
Resource Website
RRID:Addgene_100087 Ezh2[SET] Mus musculus Ampicillin PMID:28973434 Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin Ezh2[SET] includes aa 482-746 2022-04-22 03:14:46 0
Ezh2[FL]-dCas9
 
Resource Report
Resource Website
RRID:Addgene_100086 14056 Mus musculus Ampicillin PMID:28973434 Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin 2022-04-22 03:14:46 0
1D3 HC
 
Resource Report
Resource Website
RRID:Addgene_170670 HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody Mus musculus Ampicillin PMID:36378644 Predicted peptide sequences for 1D3 Heavy Chain: MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK* Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-12-22 02:15:19 0
1D3 LC
 
Resource Report
Resource Website
RRID:Addgene_170669 LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody Mus musculus Ampicillin PMID:36378644 Predicted peptide sequences for 1D3 Light Chain: MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin 2022-12-22 02:15:19 0
pDL002_Hec1-ms_IgG_LC
 
Resource Report
Resource Website
RRID:Addgene_193619 Anti-Hec1 light chain (Hec1-ms_IgG_LC) Mus musculus Kanamycin PMID:34970967 Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin 2022-12-22 02:16:02 0

Can't find your Plasmid?

We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.

If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.

Can't find the RRID you're searching for? X
X
  1. NIDDK Information Network Resources

    Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.

  2. Navigation

    You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.

  3. Logging in and Registering

    If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.

  4. Searching

    Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:

    1. Use quotes around phrases you want to match exactly
    2. You can manually AND and OR terms to change how we search between words
    3. You can add "-" to terms to make sure no results return with that term in them (ex. Cerebellum -CA1)
    4. You can add "+" to terms to require they be in the data
    5. Using autocomplete specifies which branch of our semantics you with to search and can help refine your search
  5. Collections

    If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.

  6. Facets

    Here are the facets that you can filter the data by.

  7. Further Questions

    If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.