Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
| Plasmid Name | Proper Citation | Insert Name | Organism | Bacterial Resistance | Defining Citation |
Comments |
||||
|---|---|---|---|---|---|---|---|---|---|---|
|
pKAM-E-Flag-BFP Resource Report Resource Website |
RRID:Addgene_101867 | Evi-1 | Mus musculus | Ampicillin | PMID: | Vector Backbone:pLV-EF1a-PGK-BFPT2aPuro; Vector Types:Mammalian Expression, Lentiviral; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:11 | 0 | ||
|
pcDNA3.1-ME-Flag Resource Report Resource Website |
RRID:Addgene_101860 | Mds1-Evi-1 | Mus musculus | Ampicillin | PMID: | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:11 | 0 | ||
|
pUC19, containing H2-Kb c57/BL6 WK9 Resource Report Resource Website |
RRID:Addgene_102641 | H2-Kd Balb/c | Mus musculus | Ampicillin | PMID:28374766 | Backbone Size:2300; Vector Backbone:puc19; Vector Types:; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:17 | 0 | ||
|
pUC19, containing H2-Kd Balb/c WK10 Resource Report Resource Website |
RRID:Addgene_102642 | H2-Kd Balb/c | Mus musculus | Ampicillin | PMID:28374766 | Backbone Marker:New England Biolabs, USA; Backbone Size:2300; Vector Backbone:puc19; Vector Types:; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:17 | 0 | ||
|
pcDNA3.1-Hygro(+)-mscGAS Resource Report Resource Website 1+ mentions |
RRID:Addgene_102607 | cGAS | Mus musculus | Ampicillin | PMID:26229115 | Vector Backbone:pcDNA3.1-Hygro(+); Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:17 | 1 | ||
|
pcDNA-f:PGC1 Resource Report Resource Website |
RRID:Addgene_1026 | PPAR gamma coactivator 1 alpha | Mus musculus | Ampicillin | PMID:10983978 | Backbone Marker:Invitrogen; Backbone Size:5500; Vector Backbone:pcDNA3.1 myc-His A; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:16 | 0 | ||
|
EphA2 430-976 pcDNA3.1 Resource Report Resource Website |
RRID:Addgene_102738 | EphA2 N terminal (430-976aa) | Mus musculus | Ampicillin | PMID:26744526 | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-04-22 03:15:19 | 0 | ||
|
Y771F EphA2 pcDNA3 Resource Report Resource Website |
RRID:Addgene_102735 | EphA2 | Mus musculus | Ampicillin | PMID:18387945 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Y771F (TAC > TTC) | 2022-04-22 03:15:19 | 0 | |
|
Y593E EphA2 pcDNA3 Resource Report Resource Website |
RRID:Addgene_102731 | EphA2 | Mus musculus | Ampicillin | PMID:18387945 | Backbone Marker:Invitrogen; Vector Backbone:pcDNA3; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | Y593E (TAC > GAG) | 2022-04-22 03:15:19 | 0 | |
|
pCMV-5U-Venus-PSD-95-3U Resource Report Resource Website |
RRID:Addgene_102949 | PSD-95 | Mus musculus | Kanamycin | PMID:25948262 | Backbone Size:4141; Vector Backbone:pCMV; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-04-22 03:15:22 | 0 | ||
|
pCS2MT-mbeta-catenin delta6 Resource Report Resource Website |
RRID:Addgene_100883 | Ctnnb1 | Mus musculus | Ampicillin | PMID:28390865 | Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | truncated Ctnnb1 489-781aa | 2022-04-22 03:14:58 | 0 | |
|
pCS2MT-mbeta-catenin delta7 Resource Report Resource Website |
RRID:Addgene_100884 | Ctnnb1 | Mus musculus | Ampicillin | PMID:28390865 | Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | truncated Ctnnb1 668-781aa | 2022-04-22 03:14:58 | 0 | |
|
pCS2MT-mbeta-catenin delta1 Resource Report Resource Website |
RRID:Addgene_100878 | Ctnnb1 | Mus musculus | Ampicillin | PMID:28390865 | Backbone Marker:Dave Turner Lab; Vector Backbone:pCS2MT; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | truncated Ctnnb1 1-150aa | 2022-04-22 03:14:58 | 0 | |
|
aCat TL2 (1-697 mTFP1-TSmod-Venus STOP) Resource Report Resource Website |
RRID:Addgene_101298 | alpha-Catenin | Mus musculus | Kanamycin | PMID:28329679 | The TS module with mTFP1-F40-venusA206K was adapted from Vinculin TS (a kind gift from Martin Schwartz [Grashoff et al., 2010]). The TSmod was cloned in to pEGFP-N1 vector at Xho1 and Not1 restriction sites. For aE-Cat-TS, the mouse N-terminal (1_697 aa) of alpha-catenin was inserted before mTFP1 by in- fusion cloning (Takara Bioscience, Clontech) at the Xho1 restriction site | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Contains amino acids 1-698 of alpha-Catenin | 2022-04-22 03:15:04 | 0 |
|
aCat TS WT (1-697 mTFP1-TSmod-Venus 698-907) Resource Report Resource Website |
RRID:Addgene_101299 | alpha-Catenin | Mus musculus | Kanamycin | PMID:28329679 | The C-terminal fragment (698-906 aa) of alpha-catenin was cloned after VenusA206K at the Not1 restriction site | Vector Backbone:pEGFP-C1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | Contains amino acids 1-698 and 698-906 of alpha-Catenin | 2022-04-22 03:15:04 | 0 |
|
Ezh2[SET]-dCas9 Resource Report Resource Website |
RRID:Addgene_100087 | Ezh2[SET] | Mus musculus | Ampicillin | PMID:28973434 | Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | Ezh2[SET] includes aa 482-746 | 2022-04-22 03:14:46 | 0 | |
|
Ezh2[FL]-dCas9 Resource Report Resource Website |
RRID:Addgene_100086 | 14056 | Mus musculus | Ampicillin | PMID:28973434 | Backbone Marker:ThermoFisher; Backbone Size:5407; Vector Backbone:pcDNA3.3-TOPO; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin | 2022-04-22 03:14:46 | 0 | ||
|
1D3 HC Resource Report Resource Website |
RRID:Addgene_170670 | HC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:36378644 | Predicted peptide sequences for 1D3 Heavy Chain: MDFGLRLIFLVLVFKGVLCQVQLQQPGAELVKPGASVKMSCKASGYTFTSNNMHWVKQTPGQGLEWIGGLYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSGDSAVYYCARGIRDFFAMDYWGQGTSVTVSSASLTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSLSPGK* | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:19 | 0 | |
|
1D3 LC Resource Report Resource Website |
RRID:Addgene_170669 | LC of anti-cytochrome c, 1D3 (human) recombinant mouse monoclonal antibody | Mus musculus | Ampicillin | PMID:36378644 | Predicted peptide sequences for 1D3 Light Chain: MKFPSQLLLLLLFGIPGMRSDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGAGTKLELKRAAAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* | Vector Backbone:pcDNA3.1; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin | 2022-12-22 02:15:19 | 0 | |
|
pDL002_Hec1-ms_IgG_LC Resource Report Resource Website |
RRID:Addgene_193619 | Anti-Hec1 light chain (Hec1-ms_IgG_LC) | Mus musculus | Kanamycin | PMID:34970967 | Backbone Marker:clontech; Backbone Size:3952; Vector Backbone:pEGFP-N1; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin | 2022-12-22 02:16:02 | 0 |
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the facets that you can filter the data by.
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.