Are you sure you want to leave this community? Leaving the community will revoke any permissions you have been granted in this community.
Species: Homo sapiens
Genetic Insert: RAGE
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin
References:
Comments: The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections.
A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately.
Proper citation: RRID:Addgene_23645 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac tdTomato SRT
Vector Backbone Description: Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193187 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac tdTomato SRT
Vector Backbone Description: Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193185 Copy
Species: Homo sapiens
Genetic Insert: ANLN homology arms with mNeonGreen-linker
Vector Backbone Description: Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183834 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac tdTomato SRT
Vector Backbone Description: Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193174 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac tdTomato SRT
Vector Backbone Description: Vector Backbone:AAV-PB-SRT-tdTomato; Vector Types:AAV; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193188 Copy
Species: Homo sapiens
Genetic Insert: AAVS1 homology arms with CMV-driven mRuby2-CAAX fusion
Vector Backbone Description: Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183871 Copy
Species: Homo sapiens
Genetic Insert: RHOA sgRNA spacer
Vector Backbone Description: Vector Backbone:pX459V2.0-HypaCas9-mRuby2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183877 Copy
Species: Homo sapiens
Genetic Insert: RHOA sgRNA spacer
Vector Backbone Description: Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183878 Copy
Species: Homo sapiens
Genetic Insert: ANLN sgRNA spacer
Vector Backbone Description: Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183874 Copy
Species: Homo sapiens
Genetic Insert: TUBA1B sgRNA spacer
Vector Backbone Description: Vector Backbone:pX459V2.0-HypaCas9-mRuby2; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183888 Copy
Species: Homo sapiens
Genetic Insert: TUBA1B sgRNA spacer
Vector Backbone Description: Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183889 Copy
Species: Homo sapiens
Genetic Insert: MYH10 sgRNA spacer
Vector Backbone Description: Vector Backbone:pX459V2.0-HypaCas9; Vector Types:Mammalian Expression, CRISPR; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183887 Copy
Species: Homo sapiens
Genetic Insert: Barcoded piggyBac Puro SRT
Vector Backbone Description: Vector Backbone:PB-SRT-Puro; Vector Types:Mammalian Expression; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_193146 Copy
Species: Homo sapiens
Genetic Insert: MYH10 homology arms with mRuby2-linker
Vector Backbone Description: Backbone Marker:Thermo Fischer Scientific; Backbone Size:2974; Vector Backbone:pJET1.2; Vector Types:Mammalian Expression, CRISPR, Other, Donor template; Bacterial Resistance:Ampicillin
References:
Comments:
Proper citation: RRID:Addgene_183869 Copy
Species: Homo sapiens
Genetic Insert: PXK-PX (1-125)
Vector Backbone Description: Vector Backbone:pGEX4T2; Vector Types:Bacterial Expression; Bacterial Resistance:Ampicillin
References:
Comments: Amino Acid Sequence: MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYS
Proper citation: RRID:Addgene_119114 Copy
Species: Homo sapiens
Genetic Insert: PXK
Vector Backbone Description: Backbone Marker:Invitrogen; Backbone Size:5005; Vector Backbone:pDONR223; Vector Types:Other, Gateway Donor vector; Bacterial Resistance:Spectinomycin
References:
Comments: The ORF has no Stop codon. This design enables easy recombination into a destination vector to add an epitope tag of choice and Stop codon to the ORF. Do NOT use this plasmid directly for transfections.
A set of 4 custom lentiviral vectors is available ( pLX301 (http://www.addgene.org/25895/) , pLX302 (http://www.addgene.org/25896/) , pLX303 (http://www.addgene.org/25897/) , pLX304 (http://www.addgene.org/25890/) ) to be used to express these ORFs in mammalian cells. These plasmids are not included in the kit and must be ordered separately.
Proper citation: RRID:Addgene_23723 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192095 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192099 Copy
Species: Homo sapiens
Genetic Insert: UBASH3A
Vector Backbone Description: Vector Backbone:pDONR221; Vector Types:Mammalian Expression; Bacterial Resistance:Kanamycin
References:
Comments:
Proper citation: RRID:Addgene_192098 Copy
Can't find your Plasmid?
We recommend that you click next to the search bar to check some helpful tips on searches and refine your search firstly. If you want to find a specific plasmid, it's easier to enter an RRID or an Addgene Catalog Number to search. You can refine the search results using Facets on the left side of the search results page. If you are on the table view, you can also search in a specific column by clicking the column title and enter the keywords.
If you still could not find your plasmid in the search results, please help us by registering it into the system — it's easy. Register it with Addgene.
Welcome to the dkNET Resources search. From here you can search through a compilation of resources used by dkNET and see how data is organized within our community.
You are currently on the Community Resources tab looking through categories and sources that dkNET has compiled. You can navigate through those categories from here or change to a different tab to execute your search through. Each tab gives a different perspective on data.
If you have an account on dkNET then you can log in from here to get additional features in dkNET such as Collections, Saved Searches, and managing Resources.
Here is the search term that is being executed, you can type in anything you want to search for. Some tips to help searching:
You can save any searches you perform for quick access to later from here.
We recognized your search term and included synonyms and inferred terms along side your term to help get the data you are looking for.
If you are logged into dkNET you can add data records to your collections to create custom spreadsheets across multiple sources of data.
Here are the sources that were queried against in your search that you can investigate further.
Here are the categories present within dkNET that you can filter your data on
Here are the subcategories present within this category that you can filter your data on
If you have any further questions please check out our FAQs Page to ask questions and see our tutorials. Click this button to view this tutorial again.